PDB entry 1y8n

View 1y8n on RCSB PDB site
Description: Crystal structure of the PDK3-L2 complex
Class: transferase
Keywords: pyruvate dehydrogenase kinase 3, lipoyl-bearing domain, protein-protein complex
Deposited on 2004-12-13, released 2005-05-24
The last revision prior to the SCOP 1.75 freeze date was dated 2005-05-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.211
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
    Species: HOMO SAPIENS
    Gene: PDK3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1y8na1, d1y8na2
  • Chain 'B':
    Compound: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
    Species: HOMO SAPIENS
    Gene: DLAT, DLTA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1y8nb1
  • Heterogens: K, LPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y8nA (A:)
    ggshhhhhhgmarlenlyfqgkqpvpkqierysrfspsplsikqfldfgrdnacektsym
    flrkelpvrlantmrevnllpdnllnrpsvglvqswymqsflelleyenkspedpqvldn
    flqvlikvrnrhndvvptmaqgvieykekfgfdpfistniqyfldrfytnrisfrmlinq
    htllfggdtnpvhpkhigsidptcnvadvvkdayetakmlceqyylvapeleveefnaka
    pdkpiqvvyvpshlfhmlfelfknsmratvelyedrkegypavktlvtlgkedlsikisd
    lgggvplrkidrlfnymystaprpsleptraaplagfgyglpisrlyaryfqgdlklysm
    egvgtdaviylkalssesferlpvfnksawrhykttpeaddwsnpsseprdaskykakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y8nA (A:)
    pkqierysrfspsplsikqfldfgrdnacektsymflrkelpvrlantmrevnllpdnll
    nrpsvglvqswymqsflelleyenkspedpqvldnflqvlikvrnrhndvvptmaqgvie
    ykekfgfdpfistniqyfldrfytnrisfrmlinqhtllfggdtnpvhpkhigsidptcn
    vadvvkdayetakmlceqyylvapeleveefnakapdkpiqvvyvpshlfhmlfelfkns
    mratvelyedrkegypavktlvtlgkedlsikisdlgggvplrkidrlfnymysplfgyg
    lpisrlyaryfqgdlklysmegvgtdaviylkalssesferlpvfnksawrhykttpead
    dwsnpsseprdask
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y8nB (B:)
    ggshhhhhhgmarlenlyfqgssypphmqvllpalsptmtmgtvqrwekkvgeklsegdl
    laeietdkatigfevqeegylakilvpegtrdvplgtplciivekeadisafadyrptev
    tdlkpqvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y8nB (B:)
    sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla
    kilvpegtrdvplgtplciivekeadisafadytdlk