![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.1: Single hybrid motif [51230] (1 family) ![]() 7 to 8 strands in 2 beta-sheets |
![]() | Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins) |
![]() | Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species) component of the pyruvate dehydrogenase complex |
![]() | Species Human (Homo sapiens) [TaxId:9606] [51242] (4 PDB entries) |
![]() | Domain d1y8nb1: 1y8n B:128-229 [122758] Other proteins in same PDB: d1y8na1, d1y8na2 automatically matched to d1fyc__ complexed with k, lpa |
PDB Entry: 1y8n (more details), 2.6 Å
SCOP Domain Sequences for d1y8nb1:
Sequence, based on SEQRES records: (download)
>d1y8nb1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla kilvpegtrdvplgtplciivekeadisafadyrptevtdlk
>d1y8nb1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla kilvpegtrdvplgtplciivekeadisafadytdlk
Timeline for d1y8nb1: