PDB entry 1y13

View 1y13 on RCSB PDB site
Description: Structural Analysis of Plasmodium falciparum 6-pyruvoyl tetrahydropterin synthase (PTPS)
Class: lyase, biosynthetic protein
Keywords: Structural Genomics of Pathogenic Protozoa Consortium, SGPP, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, LYASE, BIOSYNTHETIC PROTEIN
Deposited on 2004-11-17, released 2005-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.197
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-pyruvoyl tetrahydropterin synthase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • GB NP_703938 (Start-180)
      • modified residue (149)
    Domains in SCOPe 2.07: d1y13a_
  • Chain 'B':
    Compound: 6-pyruvoyl tetrahydropterin synthase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • GB NP_703938 (Start-180)
      • modified residue (149)
    Domains in SCOPe 2.07: d1y13b_
  • Chain 'C':
    Compound: 6-pyruvoyl tetrahydropterin synthase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • GB NP_703938 (Start-180)
      • modified residue (149)
    Domains in SCOPe 2.07: d1y13c_
  • Heterogens: ZN, BIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y13A (A:)
    mahhhhhhmmkeetlnsdnssaevsvespsfsfncahfiayngfretlhghnynvslkvr
    gyvrddgyvidfsilkekvkkvcnkldhhfilpiysdvlkfenvknnikiicednseysf
    perdciklpikhssteeigqyilnqlieemdvsllksrhihyieisvsesptqkaivhky
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y13A (A:)
    nssaevsvespsfsfncahfiayngfretlhghnynvslkvrgyvrddgyvidfsilkek
    vkkvcnkldhhfilpiysdvlkfenvknnikiicednseysfperdciklpikhssteei
    gqyilnqlieemdvsllksrhihyieisvsesptqkaivhkyi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y13B (B:)
    mahhhhhhmmkeetlnsdnssaevsvespsfsfncahfiayngfretlhghnynvslkvr
    gyvrddgyvidfsilkekvkkvcnkldhhfilpiysdvlkfenvknnikiicednseysf
    perdciklpikhssteeigqyilnqlieemdvsllksrhihyieisvsesptqkaivhky
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y13B (B:)
    nssaevsvespsfsfncahfiayngfretlhghnynvslkvrgyvrddgyvidfsilkek
    vkkvcnkldhhfilpiysdvlkfenvknnikiicednseysfperdciklpikhssteei
    gqyilnqlieemdvsllksrhihyieisvsesptqkaivhkyi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y13C (C:)
    mahhhhhhmmkeetlnsdnssaevsvespsfsfncahfiayngfretlhghnynvslkvr
    gyvrddgyvidfsilkekvkkvcnkldhhfilpiysdvlkfenvknnikiicednseysf
    perdciklpikhssteeigqyilnqlieemdvsllksrhihyieisvsesptqkaivhky
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y13C (C:)
    nssaevsvespsfsfncahfiayngfretlhghnynvslkvrgyvrddgyvidfsilkek
    vkkvcnkldhhfilpiysdvlkfenvknnikiicednseysfperdciklpikhssteei
    gqyilnqlieemdvsllksrhihyieisvsesptqkaivhkyi