Lineage for d1y13a_ (1y13 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966179Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2966180Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2966409Family d.96.1.2: 6-pyruvoyl tetrahydropterin synthase [55625] (2 proteins)
  6. 2966410Protein 6-pyruvoyl tetrahydropterin synthase [55626] (4 species)
    beta-sheets of three subunits form a barrel, closed: n=12, S=12
  7. 2966411Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [118057] (1 PDB entry)
    Uniprot Q6LEZ4
  8. 2966412Domain d1y13a_: 1y13 A: [116319]
    Structural genomics target
    complexed with bio, zn

Details for d1y13a_

PDB Entry: 1y13 (more details), 2.2 Å

PDB Description: Structural Analysis of Plasmodium falciparum 6-pyruvoyl tetrahydropterin synthase (PTPS)
PDB Compounds: (A:) 6-pyruvoyl tetrahydropterin synthase

SCOPe Domain Sequences for d1y13a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y13a_ d.96.1.2 (A:) 6-pyruvoyl tetrahydropterin synthase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
nssaevsvespsfsfncahfiayngfretlhghnynvslkvrgyvrddgyvidfsilkek
vkkvcnkldhhfilpiysdvlkfenvknnikiicednseysfperdciklpikhssteei
gqyilnqlieemdvsllksrhihyieisvsesptqkaivhkyi

SCOPe Domain Coordinates for d1y13a_:

Click to download the PDB-style file with coordinates for d1y13a_.
(The format of our PDB-style files is described here.)

Timeline for d1y13a_: