Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.2: 6-pyruvoyl tetrahydropterin synthase [55625] (2 proteins) |
Protein 6-pyruvoyl tetrahydropterin synthase [55626] (4 species) beta-sheets of three subunits form a barrel, closed: n=12, S=12 |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [118057] (1 PDB entry) Uniprot Q6LEZ4 |
Domain d1y13b_: 1y13 B: [116320] Structural genomics target complexed with bio, zn |
PDB Entry: 1y13 (more details), 2.2 Å
SCOPe Domain Sequences for d1y13b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y13b_ d.96.1.2 (B:) 6-pyruvoyl tetrahydropterin synthase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} nssaevsvespsfsfncahfiayngfretlhghnynvslkvrgyvrddgyvidfsilkek vkkvcnkldhhfilpiysdvlkfenvknnikiicednseysfperdciklpikhssteei gqyilnqlieemdvsllksrhihyieisvsesptqkaivhkyi
Timeline for d1y13b_: