PDB entry 1xzw

View 1xzw on RCSB PDB site
Description: Sweet potato purple acid phosphatase/phosphate complex
Class: hydrolase
Keywords: hydrolase
Deposited on 2004-11-12, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purple acid phosphatase
    Species: Ipomoea batatas [TaxId:4120]
    Database cross-references and differences (RAF-indexed):
    • GB AAF19821
      • see remark 999 (56)
    Domains in SCOPe 2.07: d1xzwa1, d1xzwa2
  • Chain 'B':
    Compound: purple acid phosphatase
    Species: Ipomoea batatas [TaxId:4120]
    Database cross-references and differences (RAF-indexed):
    • GB AAF19821 (0-425)
      • see remark 999 (56)
    Domains in SCOPe 2.07: d1xzwb2, d1xzwb3
  • Heterogens: NAG, FUC, MAN, FE, MN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xzwA (A:)
    lpnaedvdmpwdsdvfavpsgynapqqvhitqgdyegrgviiswttpydkagankvfyws
    ensksqkramgtvvtykyynytsafihhctikdleydtkyyyrlgfgdakrqfwfvtppk
    pgpdvpyvfgligdigqthdsnttlthyeqnsakgqavlfmgdlsysnrwpnhdnnrwdt
    wgrfsersvayqpwiwtagnheidyapdigeyqpfvpftnryptpheasgsgdplwyaik
    rasahiivlssysgfvkyspqykwftselekvnrsetpwlivlvhaplynsyeahymege
    amraifepyfvyykvdivfsghvhsyerservsnvaynivnakctpvsdesapvyitigd
    ggnseglasemtqpqpsysafreasfghgifdiknrthahfswhrnqdgasveadslwll
    nrywas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xzwA (A:)
    lpnaedvdmpwdsdvfavpsgynapqqvhitqgdyegrgviiswttpydkagankvfyws
    ensksqkramgtvvtykyynytsafihhctikdleydtkyyyrlgfgdakrqfwfvtppk
    pgpdvpyvfgligdigqthdsnttlthyeqnsakgqavlfmgdlsysnrwpnhdnnrwdt
    wgrfsersvayqpwiwtagnheidyapdigeyqpfvpftnryptpheasgsgdplwyaik
    rasahiivlssysgfvkyspqykwftselekvnrsetpwlivlvhaplynsyeahymege
    amraifepyfvyykvdivfsghvhsyerservsnvaynivnakctpvsdesapvyitigd
    ggnseglasemtqpqpsysafreasfghgifdiknrthahfswhrnqdgasveadslwll
    nryw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xzwB (B:)
    lpnaedvdmpwdsdvfavpsgynapqqvhitqgdyegrgviiswttpydkagankvfyws
    ensksqkramgtvvtykyynytsafihhctikdleydtkyyyrlgfgdakrqfwfvtppk
    pgpdvpyvfgligdigqthdsnttlthyeqnsakgqavlfmgdlsysnrwpnhdnnrwdt
    wgrfsersvayqpwiwtagnheidyapdigeyqpfvpftnryptpheasgsgdplwyaik
    rasahiivlssysgfvkyspqykwftselekvnrsetpwlivlvhaplynsyeahymege
    amraifepyfvyykvdivfsghvhsyerservsnvaynivnakctpvsdesapvyitigd
    ggnseglasemtqpqpsysafreasfghgifdiknrthahfswhrnqdgasveadslwll
    nrywas