SCOPe 2.08: Domain d1xzwb3: 1xzw B:501-619

Lineage for d1xzwb3 (1xzw B:501-619)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families)

5. Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein)

6. Protein Purple acid phosphatase, N-terminal domain [49365] (2 species)

7. Species Sweet potato (Ipomoea batatas) [TaxId:4120] [117063] (1 PDB entry)
   Uniprot Q9SE00 39-462

8. Domain d1xzwb3: 1xzw B:501-619 [144583]
   Other proteins in same PDB: d1xzwa2, d1xzwb2
   complexed with fe, mn, nag, po4

Details for d1xzwb3

PDB Entry: 1xzw, 2.5 Å

PDB Description: sweet potato purple acid phosphatase/phosphate complex

PDB Compounds: (B:) purple acid phosphatase

SCOPe Domain Sequences for d1xzwb3:

Sequence; same for both SEQRES and ATOM records:

>d1xzwb3 b.1.12.1 (B:501-619) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]}
lpnaedvdmpwdsdvfavpsgynapqqvhitqgdyegrgviiswttpydkagankvfyws
ensksqkramgtvvtykyynytsafihhctikdleydtkyyyrlgfgdakrqfwfvtpp

Timeline for d1xzwb3:

• d1xzwb3 first appeared in SCOP 1.75
  
• d1xzwb3 appears in SCOPe 2.07