![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins) |
![]() | Protein Plant purple acid phosphatase, catalytic domain [56302] (2 species) also contain an Ig-like domain |
![]() | Species Sweet potato (Ipomoea batatas) [TaxId:4120] [118151] (1 PDB entry) Uniprot Q9SE00 39-462 |
![]() | Domain d1xzwb2: 1xzw B:620-926 [116273] Other proteins in same PDB: d1xzwa1, d1xzwb3 complexed with fe, mn, nag, po4 |
PDB Entry: 1xzw (more details), 2.5 Å
SCOPe Domain Sequences for d1xzwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xzwb2 d.159.1.1 (B:620-926) Plant purple acid phosphatase, catalytic domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} kpgpdvpyvfgligdigqthdsnttlthyeqnsakgqavlfmgdlsysnrwpnhdnnrwd twgrfsersvayqpwiwtagnheidyapdigeyqpfvpftnryptpheasgsgdplwyai krasahiivlssysgfvkyspqykwftselekvnrsetpwlivlvhaplynsyeahymeg eamraifepyfvyykvdivfsghvhsyerservsnvaynivnakctpvsdesapvyitig dggnseglasemtqpqpsysafreasfghgifdiknrthahfswhrnqdgasveadslwl lnrywas
Timeline for d1xzwb2: