PDB entry 1xsk

View 1xsk on RCSB PDB site
Description: Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate
Class: hydrolase
Keywords: beta(8)alpha(8) barrel and beta sandwich domains, hydrolase
Deposited on 2004-10-19, released 2004-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.235
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative family 31 glucosidase yicI
    Species: Escherichia coli [TaxId:562]
    Gene: yicI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31434 (0-771)
      • expression tag (772)
    Domains in SCOPe 2.07: d1xska1, d1xska2, d1xska3, d1xska4, d1xska5
  • Chain 'B':
    Compound: Putative family 31 glucosidase yicI
    Species: Escherichia coli [TaxId:562]
    Gene: yicI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31434 (0-771)
      • expression tag (772)
    Domains in SCOPe 2.07: d1xskb1, d1xskb2, d1xskb3, d1xskb4, d1xskb5
  • Chain 'C':
    Compound: Putative family 31 glucosidase yicI
    Species: Escherichia coli [TaxId:562]
    Gene: yicI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31434 (0-771)
      • expression tag (772)
    Domains in SCOPe 2.07: d1xskc1, d1xskc2, d1xskc3, d1xskc4, d1xskc5
  • Chain 'D':
    Compound: Putative family 31 glucosidase yicI
    Species: Escherichia coli [TaxId:562]
    Gene: yicI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31434 (0-771)
      • expression tag (772)
    Domains in SCOPe 2.07: d1xskd1, d1xskd2, d1xskd3, d1xskd4, d1xskd5
  • Chain 'E':
    Compound: Putative family 31 glucosidase yicI
    Species: Escherichia coli [TaxId:562]
    Gene: yicI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31434 (0-771)
      • expression tag (772)
    Domains in SCOPe 2.07: d1xske1, d1xske2, d1xske3, d1xske4, d1xske5
  • Chain 'F':
    Compound: Putative family 31 glucosidase yicI
    Species: Escherichia coli [TaxId:562]
    Gene: yicI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31434 (0-771)
      • expression tag (772)
    Domains in SCOPe 2.07: d1xskf1, d1xskf2, d1xskf3, d1xskf4, d1xskf5
  • Heterogens: SO4, XYF, MPO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xskA (A:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xskA (A:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xskB (B:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xskB (B:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xskC (C:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xskC (C:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xskD (D:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xskD (D:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xskE (E:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xskE (E:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xskF (F:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xskF (F:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh