Lineage for d1xskc3 (1xsk C:586-665)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810903Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (4 proteins)
  6. 2810934Protein Putative glucosidase YicI, domain 3 [117299] (1 species)
  7. 2810935Species Escherichia coli [TaxId:562] [117300] (5 PDB entries)
    Uniprot P31434
  8. 2810956Domain d1xskc3: 1xsk C:586-665 [115985]
    Other proteins in same PDB: d1xska1, d1xska2, d1xska4, d1xska5, d1xskb1, d1xskb2, d1xskb4, d1xskb5, d1xskc1, d1xskc2, d1xskc4, d1xskc5, d1xskd1, d1xskd2, d1xskd4, d1xskd5, d1xske1, d1xske2, d1xske4, d1xske5, d1xskf1, d1xskf2, d1xskf4, d1xskf5
    complexed with mpo, so4, xyf

Details for d1xskc3

PDB Entry: 1xsk (more details), 2.2 Å

PDB Description: structure of a family 31 alpha glycosidase glycosyl-enzyme intermediate
PDB Compounds: (C:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1xskc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xskc3 b.71.1.4 (C:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli [TaxId: 562]}
pmmrammmefpddpacdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeld
gsrwhkqqhgflslpvyvrd

SCOPe Domain Coordinates for d1xskc3:

Click to download the PDB-style file with coordinates for d1xskc3.
(The format of our PDB-style files is described here.)

Timeline for d1xskc3: