Lineage for d1xskf4 (1xsk F:248-585)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832243Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (6 proteins)
    Pfam PF01055
  6. 2832277Protein Putative glucosidase YicI, domain 2 [117373] (1 species)
  7. 2832278Species Escherichia coli [TaxId:562] [117374] (5 PDB entries)
    Uniprot P31434
  8. 2832302Domain d1xskf4: 1xsk F:248-585 [115998]
    Other proteins in same PDB: d1xska1, d1xska2, d1xska3, d1xska5, d1xskb1, d1xskb2, d1xskb3, d1xskb5, d1xskc1, d1xskc2, d1xskc3, d1xskc5, d1xskd1, d1xskd2, d1xskd3, d1xskd5, d1xske1, d1xske2, d1xske3, d1xske5, d1xskf1, d1xskf2, d1xskf3, d1xskf5
    complexed with mpo, so4, xyf

Details for d1xskf4

PDB Entry: 1xsk (more details), 2.2 Å

PDB Description: structure of a family 31 alpha glycosidase glycosyl-enzyme intermediate
PDB Compounds: (F:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1xskf4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xskf4 c.1.8.13 (F:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]}
kavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlplhvfhfdc
fwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkelqekgyll
krpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfgeriptdvqw
fdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwggdcyany
esmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlhgsksyrv
pwayddescdvvrfftqlkcrmmpylyreaaranargt

SCOPe Domain Coordinates for d1xskf4:

Click to download the PDB-style file with coordinates for d1xskf4.
(The format of our PDB-style files is described here.)

Timeline for d1xskf4: