PDB entry 1x5j

View 1x5j on RCSB PDB site
Description: The solution structure of the fifth fibronectin type III domain of human Neogenin
Class: cell adhesion
Keywords: RGM binding, fibronectin type III domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
Deposited on 2005-05-15, released 2005-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neogenin
    Species: Homo sapiens [TaxId:9606]
    Gene: NEO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92859 (7-106)
      • cloning artifact (0-6)
      • cloning artifact (107-112)
    Domains in SCOPe 2.07: d1x5ja1, d1x5ja2, d1x5ja3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1x5jA (A:)
gssgssgpmmppvgvqasilshdtiritwadnslpkhqkitdsryytvrwktnipantky
knanattlsylvtglkpntlyefsvmvtkgrrsstwsmtahgttfelsgpssg