![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Neogenin [141053] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141054] (6 PDB entries) Uniprot Q92859 429-535! Uniprot Q92859 529-631! Uniprot Q92859 623-741! Uniprot Q92859 718-830! Uniprot Q92859 853-952! Uniprot Q92859 942-1054 |
![]() | Domain d1x5ja1: 1x5j A:8-107 [121711] Other proteins in same PDB: d1x5ja2, d1x5ja3 |
PDB Entry: 1x5j (more details)
SCOPe Domain Sequences for d1x5ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} pmmppvgvqasilshdtiritwadnslpkhqkitdsryytvrwktnipantkyknanatt lsylvtglkpntlyefsvmvtkgrrsstwsmtahgttfel
Timeline for d1x5ja1: