PDB entry 1wxm

View 1wxm on RCSB PDB site
Description: Solution Structure of the N-terminal Ras-binding Domain (RBD) in Human a-Raf Kinase
Class: Transferase
Keywords: Ras-binding domain (RBD), ubiquitin-like fold, a-Raf kinase, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Transferase
Deposited on 2005-01-26, released 2005-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: A-Raf proto-oncogene serine/threonine-protein kinase
  Species: Homo sapiens [TaxId:9606]
  Gene: ARAF1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10398 (7-79)
    • cloning artifact (0-6)
    • cloning artifact (80-85)
  Domains in SCOPe 2.06: d1wxma1, d1wxma2, d1wxma3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wxmA (A:)
  gssgssggtvkvylpnkqrtvvtvrdgmsvydsldkalkvrglnqdccvvyrlikgrktv
  tawdtaiapldgeelivevlsgpssg