SCOPe 2.06: Domain d1wxma1: 1wxm A:8-80

Lineage for d1wxma1 (1wxm A:8-80)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
   contains Pfam PF00788 and Pfam PF02196

6. Protein A-Raf proto-oncogene serine/threonine-protein kinase [142968] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142969] (1 PDB entry)
   Uniprot P10398 19-91

8. Domain d1wxma1: 1wxm A:8-80 [121402]
   Other proteins in same PDB: d1wxma2, d1wxma3

Details for d1wxma1

PDB Entry: 1wxm

PDB Description: solution structure of the n-terminal ras-binding domain (rbd) in human a-raf kinase

PDB Compounds: (A:) A-Raf proto-oncogene serine/threonine-protein kinase

SCOPe Domain Sequences for d1wxma1:

Sequence; same for both SEQRES and ATOM records:

>d1wxma1 d.15.1.5 (A:8-80) A-Raf proto-oncogene serine/threonine-protein kinase {Human (Homo sapiens) [TaxId: 9606]}
gtvkvylpnkqrtvvtvrdgmsvydsldkalkvrglnqdccvvyrlikgrktvtawdtai
apldgeelivevl

Timeline for d1wxma1:

• d1wxma1 first appeared in SCOP 1.73
  
• d1wxma1 appears in SCOPe 2.05
  
• d1wxma1 appears in SCOPe 2.07
  
• d1wxma1 appears in the current release, SCOPe 2.08