PDB entry 1wa8

View 1wa8 on RCSB PDB site
Description: solution structure of the cfp-10.esat-6 complex. major virulence determinants of pathogenic mycobacteria
Class: tuberculosis
Keywords: tuberculosis, cfp-10, esat-6, helix-turn-helix, four helix bundle, mycobacteria, pathogenesis, nmr, solution structure, psi, protein structure initiative, tb structural genomics consortium, tbsgc
Deposited on 2004-10-25, released 2005-06-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: esat-6 like protein esxb
  Species: MYCOBACTERIUM BOVIS [TaxId:1765]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O69739 (0-98)
  Domains in SCOPe 2.02: d1wa8a1
• Chain 'B':
  Compound: 6 kda early secretory antigenic target (esat-6)
  Species: Mycobacterium tuberculosis [TaxId:83332]
  Database cross-references and differences (RAF-indexed):
  • PDB 1WA8 (0-0)
  • Uniprot Q57165 (1-94)
  Domains in SCOPe 2.02: d1wa8b1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wa8A (A:)
  aemktdaatlaqeagnferisgdlktqidqvestagslqgqwrgaagtaaqaavvrfqea
  ankqkqeldeistnirqagvqysradeeqqqalssqmgf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wa8B (B:)
  mteqqwnfagieaaasaiqgnvtsihslldegkqsltklaaawggsgseayqgvqqkwda
  tatelnnalqnlartiseagqamastegnvtgmfa