Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals |
Family a.25.3.1: ESAT-6 like [140454] (3 proteins) Pfam PF06013; the conserwed WxG motif makes the turn at the alpha-hairpin tip |
Protein ESAT-6 like protein EsxB [140455] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [140456] (1 PDB entry) Uniprot P0A566 1-99 |
Domain d1wa8a1: 1wa8 A:1-99 [120809] Other proteins in same PDB: d1wa8b1 |
PDB Entry: 1wa8 (more details)
SCOPe Domain Sequences for d1wa8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wa8a1 a.25.3.1 (A:1-99) ESAT-6 like protein EsxB {Mycobacterium tuberculosis [TaxId: 1773]} aemktdaatlaqeagnferisgdlktqidqvestagslqgqwrgaagtaaqaavvrfqea ankqkqeldeistnirqagvqysradeeqqqalssqmgf
Timeline for d1wa8a1: