Lineage for d1wa8a1 (1wa8 A:1-99)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1085854Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) (S)
    (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals
  5. 1085855Family a.25.3.1: ESAT-6 like [140454] (3 proteins)
    Pfam PF06013; the conserwed WxG motif makes the turn at the alpha-hairpin tip
  6. 1085856Protein ESAT-6 like protein EsxB [140455] (1 species)
  7. 1085857Species Mycobacterium tuberculosis [TaxId:1773] [140456] (1 PDB entry)
    Uniprot P0A566 1-99
  8. 1085858Domain d1wa8a1: 1wa8 A:1-99 [120809]
    Other proteins in same PDB: d1wa8b1

Details for d1wa8a1

PDB Entry: 1wa8 (more details)

PDB Description: solution structure of the cfp-10.esat-6 complex. major virulence determinants of pathogenic mycobacteria
PDB Compounds: (A:) esat-6 like protein esxb

SCOPe Domain Sequences for d1wa8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wa8a1 a.25.3.1 (A:1-99) ESAT-6 like protein EsxB {Mycobacterium tuberculosis [TaxId: 1773]}
aemktdaatlaqeagnferisgdlktqidqvestagslqgqwrgaagtaaqaavvrfqea
ankqkqeldeistnirqagvqysradeeqqqalssqmgf

SCOPe Domain Coordinates for d1wa8a1:

Click to download the PDB-style file with coordinates for d1wa8a1.
(The format of our PDB-style files is described here.)

Timeline for d1wa8a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wa8b1