PDB entry 1w6o

View 1w6o on RCSB PDB site
Description: x-ray crystal structure of c2s human galectin-1 complexed with lactose
Class: sugar binding protein
Keywords: lectin, carbohydrate-binding proteins, galactosides, galectin, sugar binding protein
Deposited on 2004-08-20, released 2004-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: galectin-1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09382 (0-133)
    • engineered mutation (1)
    • engineered mutation (64)
  Domains in SCOPe 2.07: d1w6oa_
• Chain 'B':
  Compound: galectin-1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09382 (0-133)
    • engineered mutation (1)
    • engineered mutation (64)
  Domains in SCOPe 2.07: d1w6ob_
• Heterogens: BME, LAT, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1w6oA (A:)
  asglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
  nskddgawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
  aadgdfkikcvafd
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1w6oB (B:)
  asglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
  nskddgawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
  aadgdfkikcvafd