Lineage for d1w6oa_ (1w6o A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2388863Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2388881Protein Galectin-1 [100925] (5 species)
  7. 2388898Species Human (Homo sapiens) [TaxId:9606] [101638] (32 PDB entries)
    Uniprot P09382
  8. 2388927Domain d1w6oa_: 1w6o A: [114277]
    complexed with bme, lat, so4

Details for d1w6oa_

PDB Entry: 1w6o (more details), 1.9 Å

PDB Description: x-ray crystal structure of c2s human galectin-1 complexed with lactose
PDB Compounds: (A:) galectin-1

SCOPe Domain Sequences for d1w6oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w6oa_ b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
asglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskddgawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd

SCOPe Domain Coordinates for d1w6oa_:

Click to download the PDB-style file with coordinates for d1w6oa_.
(The format of our PDB-style files is described here.)

Timeline for d1w6oa_: