PDB entry 1w0t

View 1w0t on RCSB PDB site
Description: htrf1 DNA-binding domain in complex with telomeric DNA.
Class: DNA-binding protein
Keywords: telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein, chromosomal protein, phosphorylation, ADP-ribosylation
Deposited on 2004-06-11, released 2004-12-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.252
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: telomeric repeat binding factor 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w0ta_
  • Chain 'B':
    Compound: telomeric repeat binding factor 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w0tb_
  • Chain 'C':
    Compound: 5'-d(*cp*tp*gp*tp*tp*ap*gp*gp*gp*tp *tp*ap*gp*gp*gp*tp*tp*ap*g)-3'
  • Chain 'D':
    Compound: 5'-d(*tp*cp*tp*ap*ap*cp*cp*cp*tp*ap *ap*cp*cp*cp*tp*ap*ap*cp*a)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w0tA (A:)
    krqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w0tA (A:)
    krqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w0tB (B:)
    krqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w0tB (B:)
    krqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkkl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.