Lineage for d1w0ta_ (1w0t A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981505Family a.4.1.4: DNA-binding domain of telomeric protein [46745] (3 protein domains)
    part of Pfam PF00249 (Myb/SANT domain)
  6. 1981506Protein DNA-binding domain of human telomeric protein, hTRF1 [46746] (1 species)
  7. 1981507Species Human (Homo sapiens) [TaxId:9606] [46747] (4 PDB entries)
    Uniprot P54274 379-430 # structure of dimerisation domain (62-265) is also known (63603)
  8. 1981508Domain d1w0ta_: 1w0t A: [114070]
    protein/DNA complex

Details for d1w0ta_

PDB Entry: 1w0t (more details), 2 Å

PDB Description: htrf1 dna-binding domain in complex with telomeric dna.
PDB Compounds: (A:) telomeric repeat binding factor 1

SCOPe Domain Sequences for d1w0ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]}
krqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkkl

SCOPe Domain Coordinates for d1w0ta_:

Click to download the PDB-style file with coordinates for d1w0ta_.
(The format of our PDB-style files is described here.)

Timeline for d1w0ta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w0tb_