SCOPe 2.08: Domain d1w0tb_: 1w0t B:

Lineage for d1w0tb_ (1w0t B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.4: DNA-binding domain of telomeric protein [46745] (3 proteins)
   part of Pfam PF00249 (Myb/SANT domain)

6. Protein DNA-binding domain of human telomeric protein, hTRF1 [46746] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46747] (4 PDB entries)
   Uniprot P54274 379-430 # structure of dimerisation domain (62-265) is also known (63603)

8. Domain d1w0tb_: 1w0t B: [114071]
   protein/DNA complex

Details for d1w0tb_

PDB Entry: 1w0t, 2 Å

PDB Description: htrf1 dna-binding domain in complex with telomeric dna.

PDB Compounds: (B:) telomeric repeat binding factor 1

SCOPe Domain Sequences for d1w0tb_:

Sequence; same for both SEQRES and ATOM records:

>d1w0tb_ a.4.1.4 (B:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]}
krqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkkl

Timeline for d1w0tb_:

• d1w0tb_ first appeared in SCOP 1.71
  
• d1w0tb_ appears in SCOPe 2.07