PDB entry 1w0d

View 1w0d on RCSB PDB site
Description: The high resolution structure of Mycobacterium tuberculosis LeuB (Rv2995c)
Class: oxidoreductase
Keywords: dehydrogenase, oxidoreductase, leucine biosynthesis, nad, structural genomics, psi, protein structure initiative, tb structural genomics consortium, tb, tbsgc
Deposited on 2004-06-03, released 2004-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 1.6500000000000001 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W0D (0-0)
    • Uniprot P95313 (2-336)
    Domains in SCOPe 2.08: d1w0da1, d1w0da2
  • Chain 'B':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W0D (0-0)
    • Uniprot P95313 (2-336)
    Domains in SCOPe 2.08: d1w0db1, d1w0db2
  • Chain 'C':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W0D (0-0)
    • Uniprot P95313 (2-336)
    Domains in SCOPe 2.08: d1w0dc1, d1w0dc2
  • Chain 'D':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W0D (0-0)
    • Uniprot P95313 (2-336)
    Domains in SCOPe 2.08: d1w0dd1, d1w0dd2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w0dA (A:)
    msklaiiagdgigpevtaeavkvldavvpgvqktsydlgarrfhatgevlpdsvvaelrn
    hdaillgaigdpsvpsgvlerglllrlrfeldhhinlrparlypgvasplsgnpgidfvv
    vregtegpytgnggairvgtpnevatevsvntafgvrrvvadaferarrrrkhltlvhkt
    nvltfagglwlrtvdevgecypdvevayqhvdaatihmitdpgrfdvivtdnlfgdiitd
    laaavcggiglaasgnidatranpsmfepvhgsapdiagqgiadptaaimsvalllshlg
    ehdaaarvdraveahlatrgserlatsdvgeriaaal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w0dB (B:)
    msklaiiagdgigpevtaeavkvldavvpgvqktsydlgarrfhatgevlpdsvvaelrn
    hdaillgaigdpsvpsgvlerglllrlrfeldhhinlrparlypgvasplsgnpgidfvv
    vregtegpytgnggairvgtpnevatevsvntafgvrrvvadaferarrrrkhltlvhkt
    nvltfagglwlrtvdevgecypdvevayqhvdaatihmitdpgrfdvivtdnlfgdiitd
    laaavcggiglaasgnidatranpsmfepvhgsapdiagqgiadptaaimsvalllshlg
    ehdaaarvdraveahlatrgserlatsdvgeriaaal
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w0dC (C:)
    msklaiiagdgigpevtaeavkvldavvpgvqktsydlgarrfhatgevlpdsvvaelrn
    hdaillgaigdpsvpsgvlerglllrlrfeldhhinlrparlypgvasplsgnpgidfvv
    vregtegpytgnggairvgtpnevatevsvntafgvrrvvadaferarrrrkhltlvhkt
    nvltfagglwlrtvdevgecypdvevayqhvdaatihmitdpgrfdvivtdnlfgdiitd
    laaavcggiglaasgnidatranpsmfepvhgsapdiagqgiadptaaimsvalllshlg
    ehdaaarvdraveahlatrgserlatsdvgeriaaal
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w0dD (D:)
    msklaiiagdgigpevtaeavkvldavvpgvqktsydlgarrfhatgevlpdsvvaelrn
    hdaillgaigdpsvpsgvlerglllrlrfeldhhinlrparlypgvasplsgnpgidfvv
    vregtegpytgnggairvgtpnevatevsvntafgvrrvvadaferarrrrkhltlvhkt
    nvltfagglwlrtvdevgecypdvevayqhvdaatihmitdpgrfdvivtdnlfgdiitd
    laaavcggiglaasgnidatranpsmfepvhgsapdiagqgiadptaaimsvalllshlg
    ehdaaarvdraveahlatrgserlatsdvgeriaaal