Lineage for d1w0dc1 (1w0d C:1A-336)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2905793Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2905794Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (11 species)
  7. 2905809Species Mycobacterium tuberculosis [TaxId:1773] [117725] (2 PDB entries)
    Uniprot P95313
  8. 2905812Domain d1w0dc1: 1w0d C:1A-336 [114062]
    Other proteins in same PDB: d1w0da2, d1w0db2, d1w0dc2, d1w0dd2
    complexed with so4

Details for d1w0dc1

PDB Entry: 1w0d (more details), 1.65 Å

PDB Description: the high resolution structure of mycobacterium tuberculosis leub (rv2995c)
PDB Compounds: (C:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d1w0dc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0dc1 c.77.1.1 (C:1A-336) 3-isopropylmalate dehydrogenase, IPMDH {Mycobacterium tuberculosis [TaxId: 1773]}
sklaiiagdgigpevtaeavkvldavvpgvqktsydlgarrfhatgevlpdsvvaelrnh
daillgaigdpsvpsgvlerglllrlrfeldhhinlrparlypgvasplsgnpgidfvvv
regtegpytgnggairvgtpnevatevsvntafgvrrvvadaferarrrrkhltlvhktn
vltfagglwlrtvdevgecypdvevayqhvdaatihmitdpgrfdvivtdnlfgdiitdl
aaavcggiglaasgnidatranpsmfepvhgsapdiagqgiadptaaimsvalllshlge
hdaaarvdraveahlatrgserlatsdvgeriaaal

SCOPe Domain Coordinates for d1w0dc1:

Click to download the PDB-style file with coordinates for d1w0dc1.
(The format of our PDB-style files is described here.)

Timeline for d1w0dc1: