SCOPe 2.08: Domain d1w0db1: 1w0d B:1A-336

Lineage for d1w0db1 (1w0d B:1A-336)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (11 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [117725] (2 PDB entries)
   Uniprot P95313

8. Domain d1w0db1: 1w0d B:1A-336 [114061]
   Other proteins in same PDB: d1w0da2, d1w0db2, d1w0dc2, d1w0dd2
   complexed with so4

Details for d1w0db1

PDB Entry: 1w0d, 1.65 Å

PDB Description: the high resolution structure of mycobacterium tuberculosis leub (rv2995c)

PDB Compounds: (B:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d1w0db1:

Sequence; same for both SEQRES and ATOM records:

>d1w0db1 c.77.1.1 (B:1A-336) 3-isopropylmalate dehydrogenase, IPMDH {Mycobacterium tuberculosis [TaxId: 1773]}
sklaiiagdgigpevtaeavkvldavvpgvqktsydlgarrfhatgevlpdsvvaelrnh
daillgaigdpsvpsgvlerglllrlrfeldhhinlrparlypgvasplsgnpgidfvvv
regtegpytgnggairvgtpnevatevsvntafgvrrvvadaferarrrrkhltlvhktn
vltfagglwlrtvdevgecypdvevayqhvdaatihmitdpgrfdvivtdnlfgdiitdl
aaavcggiglaasgnidatranpsmfepvhgsapdiagqgiadptaaimsvalllshlge
hdaaarvdraveahlatrgserlatsdvgeriaaal

Timeline for d1w0db1:

• d1w0db1 first appeared in SCOP 1.71, called d1w0db_
  
• d1w0db1 appears in SCOPe 2.07