PDB entry 1vwe

View 1vwe on RCSB PDB site
Description: streptavidin-cyclo-ac-[chpqfc]-nh2, ph 3.6
Deposited on 1997-03-03, released 1998-03-18
The last revision prior to the SCOP 1.55 freeze date was dated 1998-03-18, with a file datestamp of 1998-03-18.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.203
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.55: d1vweb_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1vweB (B:)
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v