PDB entry 1vgf

View 1vgf on RCSB PDB site
Description: volvatoxin A2 (diamond crystal form)
Class: toxin
Keywords: toxin, pore formation, fungus, cardiotoxin
Deposited on 2004-04-24, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.214
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: volvatoxin A2
    Species: Volvariella volvacea [TaxId:36659]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vgfa_
  • Chain 'B':
    Compound: volvatoxin A2
    Species: Volvariella volvacea [TaxId:36659]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vgfb_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vgfA (A:)
    asddnvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsf
    dkydqstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflq
    fntnnvkknssweyrvlfsvpfgdnapsyfyslvttilitadieektgwwgltsstkknf
    avqidalelvvkkgfkapn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgfA (A:)
    nvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsfdkyd
    qstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflqfntn
    nvkknssweyrvlfsvpfgdnapsyfyslvttilitadieektgwwgltsstkknfavqi
    dalelvvkkgfkap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vgfB (B:)
    asddnvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsf
    dkydqstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflq
    fntnnvkknssweyrvlfsvpfgdnapsyfyslvttilitadieektgwwgltsstkknf
    avqidalelvvkkgfkapn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgfB (B:)
    nvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsfdkyd
    qstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflqfntn
    nvkknssweyrvlfsvpfgdnapsyfyslvttilitadieektgwwgltsstkknfavqi
    dalelvvkkgfkap