Lineage for d1vgfb_ (1vgf B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.103: CytB endotoxin-like [55675] (1 superfamily)
    core: beta-alpha(2)-beta-alpha(2)-beta(4); 3 layers: a/b/a
  4. Superfamily d.103.1: CytB endotoxin-like [55676] (1 family) (S)
  5. Family d.103.1.1: CytB endotoxin-like [55677] (2 proteins)
    Pfam PF01338
  6. Protein Volvatoxin A2 [111090] (1 species)
  7. Species Volvariella volvacea, different isoforms [TaxId:36659] [111091] (4 PDB entries)
    Uniprot Q6USC4
  8. Domain d1vgfb_: 1vgf B: [113646]
    complexed with act

Details for d1vgfb_

PDB Entry: 1vgf (more details), 2.6 Å

PDB Description: volvatoxin A2 (diamond crystal form)
PDB Compounds: (B:) volvatoxin A2

SCOPe Domain Sequences for d1vgfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgfb_ d.103.1.1 (B:) Volvatoxin A2 {Volvariella volvacea, different isoforms [TaxId: 36659]}
nvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsfdkyd
qstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflqfntn
nvkknssweyrvlfsvpfgdnapsyfyslvttilitadieektgwwgltsstkknfavqi
dalelvvkkgfkap

SCOPe Domain Coordinates for d1vgfb_ are not available.

Timeline for d1vgfb_:

Domains from other chains:
(mouse over for more information)
d1vgfa_