SCOPe 2.08: Domain d1vgfa_: 1vgf A:

Lineage for d1vgfa_ (1vgf A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.103: CytB endotoxin-like [55675] (1 superfamily)
   core: beta-alpha(2)-beta-alpha(2)-beta(4); 3 layers: a/b/a

4. Superfamily d.103.1: CytB endotoxin-like [55676] (1 family)

5. Family d.103.1.1: CytB endotoxin-like [55677] (2 proteins)
   Pfam PF01338

6. Protein Volvatoxin A2 [111090] (1 species)

7. Species Volvariella volvacea, different isoforms [TaxId:36659] [111091] (4 PDB entries)
   Uniprot Q6USC4

8. Domain d1vgfa_: 1vgf A: [113645]
   complexed with act

Details for d1vgfa_

PDB Entry: 1vgf, 2.6 Å

PDB Description: volvatoxin A2 (diamond crystal form)

PDB Compounds: (A:) volvatoxin A2

SCOPe Domain Sequences for d1vgfa_:

Sequence; same for both SEQRES and ATOM records:

>d1vgfa_ d.103.1.1 (A:) Volvatoxin A2 {Volvariella volvacea, different isoforms [TaxId: 36659]}
nvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsfdkyd
qstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflqfntn
nvkknssweyrvlfsvpfgdnapsyfyslvttilitadieektgwwgltsstkknfavqi
dalelvvkkgfkap

Timeline for d1vgfa_:

• d1vgfa_ first appeared in SCOP 1.71
  
• d1vgfa_ appears in SCOPe 2.07