PDB entry 1v9b
View 1v9b on RCSB PDB site
Description: Crystal Structure of Pyrococcus Horikoshii CutA1 complexed with Co2+
Class: Structural genomics, unknown function
Keywords: CutA, Trimer, Divalent cation tolerance, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on
2004-01-23, released
2005-02-01
The last revision prior to the SCOPe 2.06 freeze date was dated
2013-08-07, with a file datestamp of
2013-08-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.47
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Periplasmic divalent cation tolerance protein cutA
Species: Pyrococcus horikoshii [TaxId:70601]
Gene: PH0992
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1v9ba_ - Chain 'B':
Compound: Periplasmic divalent cation tolerance protein cutA
Species: Pyrococcus horikoshii [TaxId:70601]
Gene: PH0992
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1v9bb_ - Chain 'C':
Compound: Periplasmic divalent cation tolerance protein cutA
Species: Pyrococcus horikoshii [TaxId:70601]
Gene: PH0992
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1v9bc_ - Chain 'D':
Compound: Periplasmic divalent cation tolerance protein cutA
Species: Pyrococcus horikoshii [TaxId:70601]
Gene: PH0992
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1v9bd_ - Chain 'E':
Compound: Periplasmic divalent cation tolerance protein cutA
Species: Pyrococcus horikoshii [TaxId:70601]
Gene: PH0992
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1v9be_ - Chain 'F':
Compound: Periplasmic divalent cation tolerance protein cutA
Species: Pyrococcus horikoshii [TaxId:70601]
Gene: PH0992
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1v9bf_ - Heterogens: CO, SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1v9bA (A:)
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1v9bB (B:)
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1v9bC (C:)
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1v9bD (D:)
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>1v9bE (E:)
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
- Chain 'F':
Sequence; same for both SEQRES and ATOM records: (download)
>1v9bF (F:)
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk