Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins) |
Protein Cut A1 [89931] (5 species) |
Species Pyrococcus horikoshii [TaxId:53953] [102974] (10 PDB entries) Uniprot O58720 |
Domain d1v9bb_: 1v9b B: [303214] automated match to d1ukua_ complexed with co, so4 |
PDB Entry: 1v9b (more details), 2 Å
SCOPe Domain Sequences for d1v9bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v9bb_ d.58.5.2 (B:) Cut A1 {Pyrococcus horikoshii [TaxId: 53953]} miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
Timeline for d1v9bb_: