PDB entry 1upo

View 1upo on RCSB PDB site
Description: structure and nucleic acid binding of the drosophila argonaute2 paz domain
Class: nucleic acid binding
Keywords: nucleic acid binding, RNA interference
Deposited on 2003-10-08, released 2003-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2004-05-11, with a file datestamp of 2007-04-25.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: argonaute2
    Species: Drosophila melanogaster
    Database cross-references and differences (RAF-indexed):
    • PDB 1UPO (Start-3)
    • Uniprot Q9VUQ5 (4-End)
    Domains in SCOPe 2.07: d1upoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1upoA (A:)
gamampmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvn
glsrapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsiee
gqalnrkdgatqvanmikyaats

    Sequence, based on observed residues (ATOM records): (download) 
    >1upoA (A:)
ampmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvngls
rapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsiee