![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.14: PAZ domain [101690] (2 families) ![]() |
![]() | Family b.34.14.1: PAZ domain [101691] (6 proteins) |
![]() | Protein automated matches [191296] (2 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189964] (2 PDB entries) |
![]() | Domain d1upoa_: 1upo A: [303160] automated match to d1t2sa_ |
PDB Entry: 1upo (more details)
SCOPe Domain Sequences for d1upoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1upoa_ b.34.14.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} ampmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvngls rapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsiee
Timeline for d1upoa_: