Lineage for d1upoa_ (1upo A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394857Superfamily b.34.14: PAZ domain [101690] (2 families) (S)
  5. 2394858Family b.34.14.1: PAZ domain [101691] (6 proteins)
  6. 2394888Protein automated matches [191296] (2 species)
    not a true protein
  7. 2394894Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189964] (2 PDB entries)
  8. 2394896Domain d1upoa_: 1upo A: [303160]
    automated match to d1t2sa_

Details for d1upoa_

PDB Entry: 1upo (more details)

PDB Description: structure and nucleic acid binding of the drosophila argonaute2 paz domain
PDB Compounds: (A:) argonaute2

SCOPe Domain Sequences for d1upoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upoa_ b.34.14.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ampmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvngls
rapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsiee

SCOPe Domain Coordinates for d1upoa_:

Click to download the PDB-style file with coordinates for d1upoa_.
(The format of our PDB-style files is described here.)

Timeline for d1upoa_: