PDB entry 1uhe

View 1uhe on RCSB PDB site
Description: Crystal structure of aspartate decarboxylase, isoaspargine complex
Class: lyase
Keywords: double-psi beta barrel, LYASE
Deposited on 2003-07-01, released 2004-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.206
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Aspartate 1-decarboxylase alpha chain
  Species: Helicobacter pylori [TaxId:210]
  Gene: PAND
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56065 (0-91)
    • cloning artifact (92-96)
  Domains in SCOPe 2.07: d1uhe.1
• Chain 'B':
  Compound: Aspartate 1-decarboxylase beta chain
  Species: Helicobacter pylori [TaxId:210]
  Gene: PAND
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56065 (0-23)
  Domains in SCOPe 2.07: d1uhe.1
• Heterogens: NSN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uheA (A:)
  itidedlaklaklregmkveivdvnngerfstyvilgkkrgeicvngaaarkvaigdvvi
  ilayasmnedeinahkpsivlvdekneilekglehhh
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uheB (B:)
  mtfemlyskihratitdanlnyig