Class b: All beta proteins [48724] (178 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (2 proteins) |
Protein Pyruvoyl dependent aspartate decarboxylase, ADC [50694] (2 species) autocatalytic enzyme |
Species Helicobacter pylori [TaxId:210] [110249] (2 PDB entries) Uniprot P56065 |
Domain d1uhe.1: 1uhe B:,A: [107847] complexed with nsn |
PDB Entry: 1uhe (more details), 1.55 Å
SCOPe Domain Sequences for d1uhe.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1uhe.1 b.52.2.1 (B:,A:) Pyruvoyl dependent aspartate decarboxylase, ADC {Helicobacter pylori [TaxId: 210]} mtfemlyskihratitdanlnyigXitidedlaklaklregmkveivdvnngerfstyvi lgkkrgeicvngaaarkvaigdvviilayasmnedeinahkpsivlvdekneilekgleh hh
Timeline for d1uhe.1: