PDB entry 1uar

View 1uar on RCSB PDB site
Description: Crystal structure of Rhodanese from Thermus thermophilus HB8
Class: transferase
Keywords: Rhodanese, Sulfurtransferase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, transferase
Deposited on 2003-03-17, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rhodanese
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uara1, d1uara2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uarA (A:)
    mgyahpevlvstdwvqehledpkvrvlevdedillydtghipgaqkidwqrdfwdpvvrd
    fiseeefaklmerlgisndttvvlygdknnwwaayafwffkynghkdvrlmnggrqkwve
    egrplttevpsyppgryevpyrdesirayrddvlehiikvkegkgalvdvrspqeyrgel
    thmpdypqegalraghipgaknipwakavnpdgtfksaeelralyeplgitkdkdivvyc
    riaersshswfvlkyllgyphvknydgswtewgnlvgvpiakgee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uarA (A:)
    gyahpevlvstdwvqehledpkvrvlevdedillydtghipgaqkidwqrdfwdpvvrdf
    iseeefaklmerlgisndttvvlygdknnwwaayafwffkynghkdvrlmnggrqkwvee
    grplttevpsyppgryevpyrdesirayrddvlehiikvkegkgalvdvrspqeyrgele
    galraghipgaknipwakavnpdgtfksaeelralyeplgitkdkdivvycriaersshs
    wfvlkyllgyphvknydgswtewgnlvgvpiakgee