PDB entry 1uag

View 1uag on RCSB PDB site
Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase
Deposited on 1997-03-13, released 1998-03-18
The last revision prior to the SCOP 1.55 freeze date was dated 1998-03-18, with a file datestamp of 1998-03-18.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.19
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1uag_ (-)
    adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
    wlmaadlivaspgialahpslsaaadagieivgdielfcreaqapivaitgsngkstvtt
    lvgemakaagvnvgvggniglpalmllddecelyvlelssfqlettsslqavaatilnvt
    edhmdrypfglqqyraaklriyenakvcvvnaddaltmpirgadercvsfgvnmgdyhln
    hqqgetwlrvkgekvlnvkemklsgqhnytnalaalaladaaglprasslkalttftglp
    hrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplaryln
    gdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasldqfk
    nfeqrgnefarlakelg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uag_ (-)
    adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
    wlmaadlivaspgialahpslsaaadagieivgdielfcreaqapivaitgsngkstvtt
    lvgemakaagvnvgvggniglpalmllddecelyvlelssfqlettsslqavaatilnvt
    edhmdrypfglqqyraaklriyenakvcvvnaddaltmpircvsfgvnmgdyhlnetwlr
    vkgekvlnvkemklsgqhnytnalaalaladaaglprasslkalttftglphrfevvleh
    ngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplarylngdnvrlycf
    grdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasldqfknfeqrgnef
    arlakelg