PDB entry 1t4a

View 1t4a on RCSB PDB site
Description: Structure of B. Subtilis PurS C2 Crystal Form
Class: structural protein
Keywords: PurS, tetramer, complex formyl glycinamide synthetase, FGAR, FGAM, STRUCTURAL PROTEIN
Deposited on 2004-04-28, released 2004-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.213
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PurS
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YEXA, BSU06460
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12049 (0-End)
      • modified residue (0)
      • modified residue (28)
      • modified residue (42)
      • modified residue (60)
    Domains in SCOPe 2.07: d1t4aa_
  • Chain 'B':
    Compound: PurS
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YEXA, BSU06460
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12049 (0-End)
      • modified residue (0)
      • modified residue (28)
      • modified residue (42)
      • modified residue (60)
    Domains in SCOPe 2.07: d1t4ab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1t4aA (A:)
mykvkvyvslkesvldpqgsavqhalhsmtynevqdvrigkymeltieksdrdldvlvke
mcekllantviedyryeveevvaq

    Sequence, based on observed residues (ATOM records): (download) 
    >1t4aA (A:)
mykvkvyvslkesvldpqgsavqhalhsmtynevqdvrigkymeltieksdrdldvlvke
mcekllantviedyryevee

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1t4aB (B:)
mykvkvyvslkesvldpqgsavqhalhsmtynevqdvrigkymeltieksdrdldvlvke
mcekllantviedyryeveevvaq

    Sequence, based on observed residues (ATOM records): (download) 
    >1t4aB (B:)
mykvkvyvslkesvldpqgsavqhalhsmtynevqdvrigkymeltieksdrdldvlvke
mcekllantviedyryevee