Lineage for d1t4aa_ (1t4a A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615512Fold d.284: PurS-like [109622] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 2615513Superfamily d.284.1: PurS-like [82697] (3 families) (S)
    segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit
  5. 2615514Family d.284.1.1: PurS subunit of FGAM synthetase [82698] (1 protein)
    automatically mapped to Pfam PF02700
  6. 2615515Protein PurS subunit of FGAM synthetase [82699] (3 species)
  7. 2615516Species Bacillus subtilis [TaxId:1423] [111001] (2 PDB entries)
    Uniprot P12049 # YexA
  8. 2615517Domain d1t4aa_: 1t4a A: [106404]

Details for d1t4aa_

PDB Entry: 1t4a (more details), 2 Å

PDB Description: Structure of B. Subtilis PurS C2 Crystal Form
PDB Compounds: (A:) PurS

SCOPe Domain Sequences for d1t4aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t4aa_ d.284.1.1 (A:) PurS subunit of FGAM synthetase {Bacillus subtilis [TaxId: 1423]}
mykvkvyvslkesvldpqgsavqhalhsmtynevqdvrigkymeltieksdrdldvlvke
mcekllantviedyryevee

SCOPe Domain Coordinates for d1t4aa_:

Click to download the PDB-style file with coordinates for d1t4aa_.
(The format of our PDB-style files is described here.)

Timeline for d1t4aa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t4ab_