PDB entry 1stw

View 1stw on RCSB PDB site
Description: solution nmr structure of the human ets1/DNA complex, minimized average structure
Class: complex (DNA-binding protein/DNA)
Keywords: complex (DNA-binding protein/DNA)
Deposited on 1995-10-14, released 1996-04-03
The last revision prior to the SCOPe 2.06 freeze date was dated 1996-04-03, with a file datestamp of 2007-04-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ets1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1stwa_
  • Chain 'B':
    Compound: deoxyribonucleic acid
  • Chain 'C':
    Compound: deoxyribonucleic acid

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1stwA (A:)
    raelnkdkpvipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpde
    varrwgkrknkpkmnyeklsrglryyydkniihktagkryvyrfv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1stwA (A:)
    vipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrk
    nkpkmnyeklsrglryyydkniihktagkryvyrfv
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.