SCOPe 2.06: Domain d1stwa_: 1stw A:

Lineage for d1stwa_ (1stw A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (9 proteins)

6. Protein automated matches [191121] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193283] (14 PDB entries)

8. Domain d1stwa_: 1stw A: [303074]
   automated match to d2stta_
   protein/DNA complex

Details for d1stwa_

PDB Entry: 1stw

PDB Description: solution nmr structure of the human ets1/dna complex, minimized average structure

PDB Compounds: (A:) ets1

SCOPe Domain Sequences for d1stwa_:

Sequence; same for both SEQRES and ATOM records:

>d1stwa_ a.4.5.21 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrk
nkpkmnyeklsrglryyydkniihktagkryvyrfv

Timeline for d1stwa_:

• d1stwa_ is new in SCOPe 2.06-stable
  
• d1stwa_ appears in SCOPe 2.07
  
• d1stwa_ appears in the current release, SCOPe 2.08