PDB entry 1sgt

View 1sgt on RCSB PDB site
Description: refined crystal structure of streptomyces griseus trypsin at 1.7 angstroms resolution
Deposited on 1988-04-13, released 1988-07-16
The last revision prior to the SCOP 1.63 freeze date was dated 1988-07-16, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.161
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1sgt__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sgt_ (-)
vvggtraaqgefpfmvrlsmgcggalyaqdivltaahcvsgsgnntsitatggvvdlqsg
aavkvrstkvlqapgyngtgkdwaliklaqpinqptlkiatttaynqgtftvagwganre
ggsqqryllkanvpfvsdaacrsaygnelvaneeicagypdtggvdtcqgdsggpmfrkd
nadewiqvgivswgygcarpgypgvytevstfasaiasaartl