![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.1: Prokaryotic proteases [50495] (11 proteins) |
![]() | Protein Trypsin [50504] (1 species) |
![]() | Species Streptomyces griseus, strain k1 [TaxId:1911] [50505] (1 PDB entry) |
![]() | Domain d1sgt__: 1sgt - [25814] complexed with ca |
PDB Entry: 1sgt (more details), 1.7 Å
SCOP Domain Sequences for d1sgt__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sgt__ b.47.1.1 (-) Trypsin {Streptomyces griseus, strain k1} vvggtraaqgefpfmvrlsmgcggalyaqdivltaahcvsgsgnntsitatggvvdlqsg aavkvrstkvlqapgyngtgkdwaliklaqpinqptlkiatttaynqgtftvagwganre ggsqqryllkanvpfvsdaacrsaygnelvaneeicagypdtggvdtcqgdsggpmfrkd nadewiqvgivswgygcarpgypgvytevstfasaiasaartl
Timeline for d1sgt__: