PDB entry 1sgg

View 1sgg on RCSB PDB site
Description: the solution structure of sam domain from the receptor tyrosine kinase ephb2, nmr, 10 structures
Class: tyrosine-protein kinase
Keywords: nmr, receptor oligomerization, eph receptors, tyrosine phosphorylation, signal transduction, tyrosine-protein kinase
Deposited on 1999-01-08, released 1999-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ephrin type-b receptor 2
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P28693
  Domains in SCOPe 2.07: d1sgga_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1sggA (A:)
  drtipdytsfntvdewldaikmsqykesfasagfttfdivsqmtvedilrvgvtlaghqk
  kilnsiqvmraqmnq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1sggA (A:)
  ytsfntvdewldaikmsqykesfasagfttfdivsqmtvedilrvgvtlaghqkkilnsi
  qvmraqm