Lineage for d1sgga_ (1sgg A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2328565Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2328613Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 2328630Protein EphB2 receptor [47776] (2 species)
  7. 2328631Species Chicken (Gallus gallus) [TaxId:9031] [47778] (1 PDB entry)
  8. 2328632Domain d1sgga_: 1sgg A: [17943]

Details for d1sgga_

PDB Entry: 1sgg (more details)

PDB Description: the solution structure of sam domain from the receptor tyrosine kinase ephb2, nmr, 10 structures
PDB Compounds: (A:) ephrin type-b receptor 2

SCOPe Domain Sequences for d1sgga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgga_ a.60.1.2 (A:) EphB2 receptor {Chicken (Gallus gallus) [TaxId: 9031]}
ytsfntvdewldaikmsqykesfasagfttfdivsqmtvedilrvgvtlaghqkkilnsi
qvmraqm

SCOPe Domain Coordinates for d1sgga_:

Click to download the PDB-style file with coordinates for d1sgga_.
(The format of our PDB-style files is described here.)

Timeline for d1sgga_: