Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) |
Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
Protein EphB2 receptor [47776] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [47778] (1 PDB entry) |
Domain d1sgga_: 1sgg A: [17943] |
PDB Entry: 1sgg (more details)
SCOPe Domain Sequences for d1sgga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sgga_ a.60.1.2 (A:) EphB2 receptor {Chicken (Gallus gallus) [TaxId: 9031]} ytsfntvdewldaikmsqykesfasagfttfdivsqmtvedilrvgvtlaghqkkilnsi qvmraqm
Timeline for d1sgga_: