PDB entry 1sco

View 1sco on RCSB PDB site
Description: scorpion toxin (osk1 toxin) with high affinity for small conductance ca(2+)-activated k+ channel in neuroblastoma-x-gluoma ng 108-15 hybrid cells, nmr, 30 structures
Deposited on 1996-04-01, released 1997-01-27
The last revision prior to the SCOP 1.55 freeze date was dated 1997-01-27, with a file datestamp of 1997-01-27.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1sco__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sco_ (-)
    gviinvkckisrqclepckkagmrfgkcmngkchctpk