PDB entry 1rm6

View 1rm6 on RCSB PDB site
Description: Structure of 4-hydroxybenzoyl-CoA reductase from Thauera aromatica
Class: oxidoreductase
Keywords: xanthine oxidase family, dimer heterotrimers, (a, b, c)2, OXIDOREDUCTASE
Deposited on 2003-11-27, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-31, with a file datestamp of 2009-03-27.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.152
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxybenzoyl-CoA reductase alpha subunit
    Species: Thauera aromatica [TaxId:59405]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33819 (Start-768)
      • see remark 999 (250)
    Domains in SCOPe 2.07: d1rm6a1, d1rm6a2
  • Chain 'B':
    Compound: 4-hydroxybenzoyl-CoA reductase beta subunit
    Species: Thauera aromatica [TaxId:59405]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rm6b1, d1rm6b2
  • Chain 'C':
    Compound: 4-hydroxybenzoyl-CoA reductase gamma subunit
    Species: Thauera aromatica [TaxId:59405]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33818 (0-End)
      • see remark 999 (141-143)
    Domains in SCOPe 2.07: d1rm6c1, d1rm6c2
  • Chain 'D':
    Compound: 4-hydroxybenzoyl-CoA reductase alpha subunit
    Species: Thauera aromatica [TaxId:59405]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33819
      • see remark 999 (250)
    Domains in SCOPe 2.07: d1rm6d1, d1rm6d2
  • Chain 'E':
    Compound: 4-hydroxybenzoyl-CoA reductase beta subunit
    Species: Thauera aromatica [TaxId:59405]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rm6e1, d1rm6e2
  • Chain 'F':
    Compound: 4-hydroxybenzoyl-CoA reductase gamma subunit
    Species: Thauera aromatica [TaxId:59405]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33818 (0-End)
      • see remark 999 (141-143)
    Domains in SCOPe 2.07: d1rm6f1, d1rm6f2
  • Heterogens: CL, K, NA, SO4, PCD, FAD, SF4, FES, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rm6A (A:)
    mspklpqhgtvgvrtplvdgvekvtgkakytadiaapdalvgrilrsphaharilaidts
    aaealegviavctgaetpvpfgvlpiaeneyplardkvryrgdpvaavaaidevtaekal
    alikvdyevlpaymtpkaamkagaialhddkpnnilrevhaefgdvaaafaeadlirekt
    ytfaevnhvhmelnatlaeydpvrdmltlntttqvpyyvhlkvaaclqmdsarirvikpf
    lgggfgartealhfeiiagllarkakgtvrllqtreetfiahrgrpwtevkmkiglkkdg
    kiaalaleatqaggayagygiitilytgalmhglyhipaikhdawrvytntppcgamrgh
    gtvdtraafealltemgeelgidslkirqinmlpqipyvtmyaqrvmsygvpeclekvka
    asgweerkgklpkgrglgialshfvsgtstpkhwtgephatvnlkldfdggitlltgaad
    igqgsntmasqvaaevlgvrlsrirvisadsaltpkdngsyssrvtfmvgnasisaaeel
    kgvlvkaaakkldareedievidemfmvsgsqdpglsfqevvkaamvdsgtitvkgtytc
    ptefqgdkkirgsaigatmgfcyaaqvveasvdeitgkvtahkvwvavdvgkalnplave
    gqtqggvwmgmgqalseetvydngrmvhgnildyrvptivespdieviivesmdpngpfg
    akeasegmlagflpaiheavyeavgvratdfplspdritelldakeaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rm6A (A:)
    gtvgvrtplvdgvekvtgkakytadiaapdalvgrilrsphaharilaidtsaaealegv
    iavctgaetpvpfgvlpiaeneyplardkvryrgdpvaavaaidevtaekalalikvdye
    vlpaymtpkaamkagaialhddkpnnilrevhaefgdvaaafaeadlirektytfaevnh
    vhmelnatlaeydpvrdmltlntttqvpyyvhlkvaaclqmdsarirvikpflgggfgar
    tealhfeiiagllarkakgtvrllqtreetfiahrgrpwtevkmkiglkkdgkiaalale
    atqaggayagygiitilytgalmhglyhipaikhdawrvytntppcgamrghgtvdtraa
    fealltemgeelgidslkirqinmlpqipyvtmyaqrvmsygvpeclekvkaasgweerk
    gklpkgrglgialshfvsgtstpkhwtgephatvnlkldfdggitlltgaadigqgsntm
    asqvaaevlgvrlsrirvisadsaltpkdngsyssrvtfmvgnasisaaeelkgvlvkaa
    akkldareedievidemfmvsgsqdpglsfqevvkaamvdsgtitvkgtytcptefqgdk
    kirgsaigatmgfcyaaqvveasvdeitgkvtahkvwvavdvgkalnplavegqtqggvw
    mgmgqalseetvydngrmvhgnildyrvptivespdieviivesmdpngpfgakeasegm
    lagflpaiheavyeavgvratdfplspdritelldakeaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rm6B (B:)
    mniltdfrthrpatladavnalaaeatlplgagtdllpnlrrglghpaalvdltgidgla
    tistladgslrigagatleaiaehdairttwpalaqaaesvagpthraaatlggnlcqdt
    rctfynqsewwrsgngyclkykgdkchvivksdrcyatyhgdvapalmvldaraeivgpa
    gkrtvpvaqlfresgaehltlekgellaaievpptgawsaayskvrirdavdfplagvaa
    alqrdgdriaglrvaitgsnsaplmvpvdallggnwddaaaetlaqlvrktsnvlrttit
    gvkyrrrvllaisrkvvdqlwear
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rm6B (B:)
    mniltdfrthrpatladavnalaaeatlplgagtdllpnlrrglghpaalvdltgidgla
    tistladgslrigagatleaiaehdairttwpalaqaaesvagpthraaatlggnlcqdt
    rctfynqsewwrsgngyclkykgdkchvivksdrcyatyhgdvapalmvldaraeivgpa
    gkrtvpvaqlfresgaehltlekgellaaievpptgawsaayskvrirdavdfplagvaa
    alqrdgdriaglrvaitgsnsaplmvpvdallggnwddaaaetlaqlvrktsnvlrttit
    gvkyrrrvllaisrkvvdqlwea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rm6C (C:)
    mknilrltlngraredlvpdnmllldylretvgltgtkqgcdggecgactvlvddrprla
    cstlahqvagkkvetveslatqgtlsklqaafheklgtqcgfctpgmimaseallrknps
    psrdeikaalagnlcrctgyvkiiksvetaaaarlceegar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rm6C (C:)
    mknilrltlngraredlvpdnmllldylretvgltgtkqgcdggecgactvlvddrprla
    cstlahqvagkkvetveslatqgtlsklqaafheklgtqcgfctpgmimaseallrknps
    psrdeikaalagnlcrctgyvkiiksvetaaaarlce
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rm6D (D:)
    mspklpqhgtvgvrtplvdgvekvtgkakytadiaapdalvgrilrsphaharilaidts
    aaealegviavctgaetpvpfgvlpiaeneyplardkvryrgdpvaavaaidevtaekal
    alikvdyevlpaymtpkaamkagaialhddkpnnilrevhaefgdvaaafaeadlirekt
    ytfaevnhvhmelnatlaeydpvrdmltlntttqvpyyvhlkvaaclqmdsarirvikpf
    lgggfgartealhfeiiagllarkakgtvrllqtreetfiahrgrpwtevkmkiglkkdg
    kiaalaleatqaggayagygiitilytgalmhglyhipaikhdawrvytntppcgamrgh
    gtvdtraafealltemgeelgidslkirqinmlpqipyvtmyaqrvmsygvpeclekvka
    asgweerkgklpkgrglgialshfvsgtstpkhwtgephatvnlkldfdggitlltgaad
    igqgsntmasqvaaevlgvrlsrirvisadsaltpkdngsyssrvtfmvgnasisaaeel
    kgvlvkaaakkldareedievidemfmvsgsqdpglsfqevvkaamvdsgtitvkgtytc
    ptefqgdkkirgsaigatmgfcyaaqvveasvdeitgkvtahkvwvavdvgkalnplave
    gqtqggvwmgmgqalseetvydngrmvhgnildyrvptivespdieviivesmdpngpfg
    akeasegmlagflpaiheavyeavgvratdfplspdritelldakeaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rm6D (D:)
    gtvgvrtplvdgvekvtgkakytadiaapdalvgrilrsphaharilaidtsaaealegv
    iavctgaetpvpfgvlpiaeneyplardkvryrgdpvaavaaidevtaekalalikvdye
    vlpaymtpkaamkagaialhddkpnnilrevhaefgdvaaafaeadlirektytfaevnh
    vhmelnatlaeydpvrdmltlntttqvpyyvhlkvaaclqmdsarirvikpflgggfgar
    tealhfeiiagllarkakgtvrllqtreetfiahrgrpwtevkmkiglkkdgkiaalale
    atqaggayagygiitilytgalmhglyhipaikhdawrvytntppcgamrghgtvdtraa
    fealltemgeelgidslkirqinmlpqipyvtmyaqrvmsygvpeclekvkaasgweerk
    gklpkgrglgialshfvsgtstpkhwtgephatvnlkldfdggitlltgaadigqgsntm
    asqvaaevlgvrlsrirvisadsaltpkdngsyssrvtfmvgnasisaaeelkgvlvkaa
    akkldareedievidemfmvsgsqdpglsfqevvkaamvdsgtitvkgtytcptefqgdk
    kirgsaigatmgfcyaaqvveasvdeitgkvtahkvwvavdvgkalnplavegqtqggvw
    mgmgqalseetvydngrmvhgnildyrvptivespdieviivesmdpngpfgakeasegm
    lagflpaiheavyeavgvratdfplspdritelldakeaa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rm6E (E:)
    mniltdfrthrpatladavnalaaeatlplgagtdllpnlrrglghpaalvdltgidgla
    tistladgslrigagatleaiaehdairttwpalaqaaesvagpthraaatlggnlcqdt
    rctfynqsewwrsgngyclkykgdkchvivksdrcyatyhgdvapalmvldaraeivgpa
    gkrtvpvaqlfresgaehltlekgellaaievpptgawsaayskvrirdavdfplagvaa
    alqrdgdriaglrvaitgsnsaplmvpvdallggnwddaaaetlaqlvrktsnvlrttit
    gvkyrrrvllaisrkvvdqlwear
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rm6E (E:)
    mniltdfrthrpatladavnalaaeatlplgagtdllpnlrrglghpaalvdltgidgla
    tistladgslrigagatleaiaehdairttwpalaqaaesvagpthraaatlggnlcqdt
    rctfynqsewwrsgngyclkykgdkchvivksdrcyatyhgdvapalmvldaraeivgpa
    gkrtvpvaqlfresgaehltlekgellaaievpptgawsaayskvrirdavdfplagvaa
    alqrdgdriaglrvaitgsnsaplmvpvdallggnwddaaaetlaqlvrktsnvlrttit
    gvkyrrrvllaisrkvvdqlwea
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1rm6F (F:)
    mknilrltlngraredlvpdnmllldylretvgltgtkqgcdggecgactvlvddrprla
    cstlahqvagkkvetveslatqgtlsklqaafheklgtqcgfctpgmimaseallrknps
    psrdeikaalagnlcrctgyvkiiksvetaaaarlceegar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rm6F (F:)
    mknilrltlngraredlvpdnmllldylretvgltgtkqgcdggecgactvlvddrprla
    cstlahqvagkkvetveslatqgtlsklqaafheklgtqcgfctpgmimaseallrknps
    psrdeikaalagnlcrctgyvkiiksvetaaaarlce