Lineage for d1rm6a1 (1rm6 A:9-133)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2944851Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 2944852Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 2944853Protein 4-hydroxybenzoyl-CoA reductase alpha subunit HrcA, N-terminal domain [117885] (1 species)
  7. 2944854Species Thauera aromatica [TaxId:59405] [117886] (2 PDB entries)
    Uniprot O33819
  8. 2944855Domain d1rm6a1: 1rm6 A:9-133 [111872]
    Other proteins in same PDB: d1rm6a2, d1rm6b1, d1rm6b2, d1rm6c1, d1rm6c2, d1rm6d2, d1rm6e1, d1rm6e2, d1rm6f1, d1rm6f2
    complexed with cl, epe, fad, fes, k, na, pcd, sf4, so4

Details for d1rm6a1

PDB Entry: 1rm6 (more details), 1.6 Å

PDB Description: Structure of 4-hydroxybenzoyl-CoA reductase from Thauera aromatica
PDB Compounds: (A:) 4-hydroxybenzoyl-CoA reductase alpha subunit

SCOPe Domain Sequences for d1rm6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rm6a1 d.41.1.1 (A:9-133) 4-hydroxybenzoyl-CoA reductase alpha subunit HrcA, N-terminal domain {Thauera aromatica [TaxId: 59405]}
gtvgvrtplvdgvekvtgkakytadiaapdalvgrilrsphaharilaidtsaaealegv
iavctgaetpvpfgvlpiaeneyplardkvryrgdpvaavaaidevtaekalalikvdye
vlpay

SCOPe Domain Coordinates for d1rm6a1:

Click to download the PDB-style file with coordinates for d1rm6a1.
(The format of our PDB-style files is described here.)

Timeline for d1rm6a1: