Lineage for d1rm6e1 (1rm6 E:217-323)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528291Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2528454Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 2528455Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)
  6. 2528456Protein 4-hydroxybenzoyl-CoA reductase beta subunit HrcB, C-terminal domain [118044] (1 species)
  7. 2528457Species Thauera aromatica [TaxId:59405] [118045] (2 PDB entries)
    Uniprot O33820
  8. 2528459Domain d1rm6e1: 1rm6 E:217-323 [111880]
    Other proteins in same PDB: d1rm6a1, d1rm6a2, d1rm6b2, d1rm6c1, d1rm6c2, d1rm6d1, d1rm6d2, d1rm6e2, d1rm6f1, d1rm6f2
    complexed with cl, epe, fad, fes, k, na, pcd, sf4, so4

Details for d1rm6e1

PDB Entry: 1rm6 (more details), 1.6 Å

PDB Description: Structure of 4-hydroxybenzoyl-CoA reductase from Thauera aromatica
PDB Compounds: (E:) 4-hydroxybenzoyl-CoA reductase beta subunit

SCOPe Domain Sequences for d1rm6e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rm6e1 d.87.2.1 (E:217-323) 4-hydroxybenzoyl-CoA reductase beta subunit HrcB, C-terminal domain {Thauera aromatica [TaxId: 59405]}
awsaayskvrirdavdfplagvaaalqrdgdriaglrvaitgsnsaplmvpvdallggnw
ddaaaetlaqlvrktsnvlrttitgvkyrrrvllaisrkvvdqlwea

SCOPe Domain Coordinates for d1rm6e1:

Click to download the PDB-style file with coordinates for d1rm6e1.
(The format of our PDB-style files is described here.)

Timeline for d1rm6e1: