PDB entry 1rkl

View 1rkl on RCSB PDB site
Description: NMR structure of yeast oligosaccharyltransferase subunit Ost4p
Class: transferase
Keywords: membrane protein, TRANSFERASE
Deposited on 2003-11-21, released 2004-03-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 4 kDa subunit
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99380 (0-35)
  Domains in SCOPe 2.06: d1rkla_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rklA (A:)
  misdeqlnslaitfgivmmtliviyhavdstmspkn